PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.382200.1
Common NameCsa_7G007860, LOC101215473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family BBR-BPC
Protein Properties Length: 325aa    MW: 36391.3 Da    PI: 10.2023
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.382200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind359.28.4e-110123241301
       GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalver 77 
                     mdd  ++e  r+k  y++              ++ ++l   +++++ms+iaerda+irernlalsekk+a+a+rd+a+ qrd+al +r+ al+er
  Cucsa.382200.1  12 MDDGRQHEngRHKLdYFRgssspwnmvppnhvKEpNALV--MNKKIMSIIAERDAAIRERNLALSEKKEALAARDEALRQRDEALVQRDSALMER 104
                     666655555788877888999999999876663335666..99**************************************************** PP

       GAGA_bind  78 dnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkk.kkks 171
                     dn+l+al+ ++n+  s+ p g +v ++tk +++l + + p+++++++++++ ++++a+pi+  a+ea ++++ k+ + +k   +k+++ + kk +
  Cucsa.382200.1 105 DNALAALEIRDNA--SNFPLGGGVQRKTKRLHHLSN-HMPNISETSYGTKDVHITDAFPITVIASEAVKSQQGKRAKDNKLVSSKTSRPPrKKVG 196
                     *********9998..77899999*********9998.78*************************9999999999877777776666664414445 PP

       GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                     e+ +++ ++++  ++ +++++ +d++ln vs+D+s++P+P+CsCtG  rqCYkWGnGGWqS+CCtt +S+yPLP   ++r+aR++grKmS+++f+
  Cucsa.382200.1 197 EDLNRHAATDG--TKYRTDWDGQDVGLNLVSFDDSSMPAPICSCTGFARQCYKWGNGGWQSSCCTTHMSMYPLPHLENKRHARMGGRKMSGSVFT 289
                     56666666666..68******************************************************************************** PP

       GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     klL++Laa G+dls pvDLkdhWA+HGtn+++tir
  Cucsa.382200.1 290 KLLSRLAAAGHDLSVPVDLKDHWARHGTNRYITIR 324
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.7E-14112324IPR010409GAGA-binding transcriptional activator
PfamPF062172.3E-9712324IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MIMSWKLFFG TMDDGRQHEN GRHKLDYFRG SSSPWNMVPP NHVKEPNALV MNKKIMSIIA  60
ERDAAIRERN LALSEKKEAL AARDEALRQR DEALVQRDSA LMERDNALAA LEIRDNASNF  120
PLGGGVQRKT KRLHHLSNHM PNISETSYGT KDVHITDAFP ITVIASEAVK SQQGKRAKDN  180
KLVSSKTSRP PRKKVGEDLN RHAATDGTKY RTDWDGQDVG LNLVSFDDSS MPAPICSCTG  240
FARQCYKWGN GGWQSSCCTT HMSMYPLPHL ENKRHARMGG RKMSGSVFTK LLSRLAAAGH  300
DLSVPVDLKD HWARHGTNRY ITIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817980.0LN681798.1 Cucumis melo genomic scaffold, anchoredscaffold00019.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148546.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_011658563.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_011658564.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_011658565.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_011658566.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_011658567.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_011658568.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-132BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A0A0K1470.0A0A0A0K147_CUCSA; Uncharacterized protein
STRINGGLYMA05G38430.21e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-127basic pentacysteine 4
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]